| Identification |
| HMDB Protein ID
| HMDBP11601 |
| Secondary Accession Numbers
| None |
| Name
| Acyl-coenzyme A thioesterase THEM5 |
| Synonyms
|
- Acyl-CoA thioesterase THEM5
- Acyl-coenzyme A thioesterase 15
- Thioesterase superfamily member 5
|
| Gene Name
| THEM5 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleyl-CoA and other unsaturated long-chain fatty acid-CoA esters. Plays an important role in mitochondrial fatty acid metabolism, and in remodeling of the mitochondrial lipid cardiolipin. Required for normal mitochondrial function.
|
| Pathways
|
Not Available
|
| Reactions
|
| Palmityl-CoA + Water → Coenzyme A + Palmitic acid |
details
|
|
| GO Classification
|
| Biological Process |
| fatty acid metabolic process |
| cardiolipin acyl-chain remodeling |
| long-chain fatty-acyl-CoA metabolic process |
| Cellular Component |
| mitochondrial matrix |
| Molecular Function |
| palmitoyl-CoA hydrolase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1q21.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 27662.51 |
| Theoretical pI
| 7.716 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|32698978|ref|NP_872384.1| acyl-coenzyme A thioesterase THEM5 [Homo sapiens]
MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNA
SWCSDMLSLY
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N1Q8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:26755 |
| References |
| General References
| Not Available |