| Identification |
| HMDB Protein ID
| HMDBP11595 |
| Secondary Accession Numbers
| None |
| Name
| DNA dC->dU-editing enzyme APOBEC-3F |
| Synonyms
|
- Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F
|
| Gene Name
| APOBEC3F |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. After being packaged into HIV-1 virions, blocks productive infection by massively editing dC residues to dU on the DNA minus strand during reverse transcription. The editing of the minus strand DNA of HIV-1 during reverse transcription leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
|
| Pathways
|
Not Available
|
| Reactions
|
| Cytidine + Water → Uridine + Ammonia |
details
|
|
| GO Classification
|
| Biological Process |
| defense response to virus |
| DNA demethylation |
| innate immune response |
| negative regulation of transposition |
| base conversion or substitution editing |
| negative regulation of retroviral genome replication |
| positive regulation of defense response to virus by host |
| Cellular Component |
| cytoplasm |
| apolipoprotein B mRNA editing enzyme complex |
| Molecular Function |
| metal ion binding |
| cytidine deaminase activity |
| zinc ion binding |
| RNA binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 22 |
| Locus
| 22q13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 11822.52 |
| Theoretical pI
| 11.133 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|54873619|ref|NP_001006667.1| DNA dC->dU-editing enzyme APOBEC-3F isoform b [Homo sapiens]
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPR
SFIRAPFQVL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IUX4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17356 |
| References |
| General References
| Not Available |