| Identification |
| HMDB Protein ID
| HMDBP11593 |
| Secondary Accession Numbers
| None |
| Name
| Probable DNA dC->dU-editing enzyme APOBEC-3C |
| Synonyms
|
- APOBEC1-like
- Phorbolin I
|
| Gene Name
| APOBEC3C |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
|
| Pathways
|
Not Available
|
| Reactions
|
| Cytidine + Water → Uridine + Ammonia |
details
|
|
| GO Classification
|
| Biological Process |
| defense response to virus |
| DNA demethylation |
| negative regulation of transposition |
| virus-host interaction |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 22 |
| Locus
| 22q13.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 22825.725 |
| Theoretical pI
| 7.59 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|22907039|ref|NP_055323.2| DNA dC->dU-editing enzyme APOBEC-3C [Homo sapiens]
MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVD
SETHCHAERC
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NRW3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17353 |
| References |
| General References
| Not Available |