| Identification |
| HMDB Protein ID
| HMDBP11523 |
| Secondary Accession Numbers
| |
| Name
| N-acetyltransferase-1 |
| Synonyms
|
Not Available
|
| Gene Name
| NAT1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Involved in acetyltransferase activity |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Function |
| catalytic activity |
| transferase activity |
| transferase activity, transferring acyl groups |
| transferase activity, transferring acyl groups other than amino-acyl groups |
| acyltransferase activity |
| acetyltransferase activity |
| Process |
| metabolic process |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Chromosome:8 |
| Locus
| 8p22 |
| SNPs
| NAT1 |
| Gene Sequence
|
>173 bp
GGACTTGGAAACATTAACTGACATTCTTCAACACCAGATCCGGGCTGTTCCCTTTGAGAA
CCTTAACATCCATTGTGGGGATGCCATGGACTTAGGCTTAGAGGCCATTTTTGATCAAGT
TGTGAGAAGAAATCGGGGTGGATGGTGTCTCCAGGTCAATCATCTTCTGTACT
|
| Protein Properties |
| Number of Residues
| 57 |
| Molecular Weight
| 6575.5 |
| Theoretical pI
| 4.82 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>N-acetyltransferase-1
DLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLY
|
| External Links |
| GenBank ID Protein
| 60502303 |
| UniProtKB/Swiss-Prot ID
| Q5C8V2 |
| UniProtKB/Swiss-Prot Entry Name
| Q5C8V2_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| AY730684 |
| GeneCard ID
| NAT1 |
| GenAtlas ID
| NAT1 |
| HGNC ID
| HGNC:7645 |
| References |
| General References
| - Jensen LE, Hoess K, Mitchell LE, Whitehead AS: Loss of function polymorphisms in NAT1 protect against spina bifida. Hum Genet. 2006 Aug;120(1):52-7. Epub 2006 May 6. [PubMed:16680433 ]
|