| Identification |
| HMDB Protein ID
| HMDBP10815 |
| Secondary Accession Numbers
| |
| Name
| B2 bradykinin receptor basal promoter, allele BP-58-T |
| Synonyms
|
Not Available
|
| Gene Name
| Not Available |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Involved in receptor activity |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| Not Available |
| Gene Sequence
|
>122 bp
GCAGAGCTCAGCTGGAGGCGGAGGGGGAAGTGCCCAGGAGGCTGATGACATCATTACCCA
GCCCTTGAAAGATGAGCTGTTCCCGCCGCCACTCCAGCTCTGGCTTCTGGGCTCCGAGGA
GG
|
| Protein Properties |
| Number of Residues
| 40 |
| Molecular Weight
| 4152.5 |
| Theoretical pI
| 3.47 |
| Pfam Domain Function
|
Not Available |
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>B2 bradykinin receptor basal promoter, allele BP-58-T
QSSAGGGGGSAQEADDIITQPLKDELFPPPLQLWLLGSEE
|
| External Links |
| GenBank ID Protein
| 1216155 |
| UniProtKB/Swiss-Prot ID
| Q13833 |
| UniProtKB/Swiss-Prot Entry Name
| Q13833_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| X91664 |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| Not Available |
| References |
| General References
| - Braun A, Maier E, Kammerer S, Muller B, Roscher AA: A novel sequence polymorphism in the promoter region of the human B2-bradykinin receptor gene. Hum Genet. 1996 May;97(5):688-9. [PubMed:8655154 ]
|