| Identification |
| HMDB Protein ID
| HMDBP10804 |
| Secondary Accession Numbers
| |
| Name
| Neutrophil defensin 4 |
| Synonyms
|
- Defensin, alpha 4
- HNP-4
- HP-4
|
| Gene Name
| DEFA4 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Involved in defense response |
| Specific Function
| Has antimicrobial activity against Gram-negative bacteria, and to a lesser extent also against Gram-positive bacteria and fungi. Protects blood cells against infection with HIV-1 (in vitro). Inhibits corticotropin (ACTH)-stimulated corticosterone production |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| extracellular region |
| extracellular region part |
| extracellular space |
| Process |
| response to stimulus |
| response to stress |
| defense response |
|
| Cellular Location
|
- Secreted
|
| Gene Properties |
| Chromosome Location
| Chromosome:8 |
| Locus
| 8p23 |
| SNPs
| DEFA4 |
| Gene Sequence
|
>294 bp
ATGAGGATTATCGCCCTCCTCGCTGCTATTCTCTTGGTAGCCCTCCAGGTCCGGGCAGGC
CCACTCCAGGCAAGAGGTGATGAGGCTCCAGGCCAGGAGCAGCGTGGGCCAGAAGACCAG
GACATATCTATTTCCTTTGCATGGGATAAAAGCTCTGCTCTTCAGGTTTCAGGCTCAACA
AGGGGCATGGTCTGCTCTTGCAGATTAGTATTCTGCCGGCGAACAGAACTTCGTGTTGGG
AACTGCCTCATTGGTGGTGTGAGTTTCACATACTGCTGCACGCGTGTCGATTAA
|
| Protein Properties |
| Number of Residues
| 97 |
| Molecular Weight
| 10504.0 |
| Theoretical pI
| 8.11 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Neutrophil defensin 4
MRIIALLAAILLVALQVRAGPLQARGDEAPGQEQRGPEDQDISISFAWDKSSALQVSGST
RGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD
|
| External Links |
| GenBank ID Protein
| 665927 |
| UniProtKB/Swiss-Prot ID
| P12838 |
| UniProtKB/Swiss-Prot Entry Name
| DEF4_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| U18745 |
| GeneCard ID
| DEFA4 |
| GenAtlas ID
| DEFA4 |
| HGNC ID
| HGNC:2763 |
| References |
| General References
| - Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
- Gabay JE, Scott RW, Campanelli D, Griffith J, Wilde C, Marra MN, Seeger M, Nathan CF: Antibiotic proteins of human polymorphonuclear leukocytes. Proc Natl Acad Sci U S A. 1989 Jul;86(14):5610-4. [PubMed:2501794 ]
- Palfree RG, Sadro LC, Solomon S: The gene encoding the human corticostatin HP-4 precursor contains a recent 86-base duplication and is located on chromosome 8. Mol Endocrinol. 1993 Feb;7(2):199-205. [PubMed:8469233 ]
- Singh A, Bateman A, Zhu QZ, Shimasaki S, Esch F, Solomon S: Structure of a novel human granulocyte peptide with anti-ACTH activity. Biochem Biophys Res Commun. 1988 Aug 30;155(1):524-9. [PubMed:2843187 ]
- Wilde CG, Griffith JE, Marra MN, Snable JL, Scott RW: Purification and characterization of human neutrophil peptide 4, a novel member of the defensin family. J Biol Chem. 1989 Jul 5;264(19):11200-3. [PubMed:2500436 ]
- Ericksen B, Wu Z, Lu W, Lehrer RI: Antibacterial activity and specificity of the six human {alpha}-defensins. Antimicrob Agents Chemother. 2005 Jan;49(1):269-75. [PubMed:15616305 ]
- Wu Z, Cocchi F, Gentles D, Ericksen B, Lubkowski J, Devico A, Lehrer RI, Lu W: Human neutrophil alpha-defensin 4 inhibits HIV-1 infection in vitro. FEBS Lett. 2005 Jan 3;579(1):162-6. [PubMed:15620707 ]
- Szyk A, Wu Z, Tucker K, Yang D, Lu W, Lubkowski J: Crystal structures of human alpha-defensins HNP4, HD5, and HD6. Protein Sci. 2006 Dec;15(12):2749-60. Epub 2006 Nov 6. [PubMed:17088326 ]
|