| Identification |
| HMDB Protein ID
| HMDBP10751 |
| Secondary Accession Numbers
| |
| Name
| Vasopressin-neurophysin |
| Synonyms
|
Not Available
|
| Gene Name
| Not Available |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Involved in neurohypophyseal hormone activity |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| extracellular region |
| Function |
| binding |
| protein binding |
| receptor binding |
| hormone activity |
| neuropeptide hormone activity |
| neurohypophyseal hormone activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| Not Available |
| Locus
| Not Available |
| SNPs
| Not Available |
| Gene Sequence
|
>117 bp
ATGCCTGACACCATGCTGCCCGCCTGCTTCCTCGGCCTACTGGCCTTCTCCTCCGCGTGC
TACTTCCAGAACTGCCCGAGGGGCGGCAAGAGGGCCATGTCCGACCTGGAGCTGAGA
|
| Protein Properties |
| Number of Residues
| 39 |
| Molecular Weight
| 4312.0 |
| Theoretical pI
| 8.04 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Vasopressin-neurophysin
MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELR
|
| External Links |
| GenBank ID Protein
| 2625108 |
| UniProtKB/Swiss-Prot ID
| Q9UEW6 |
| UniProtKB/Swiss-Prot Entry Name
| Q9UEW6_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| AF031475 |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:894 |
| References |
| General References
| - Bahnsen U, Oosting P, Swaab DF, Nahke P, Richter D, Schmale H: A missense mutation in the vasopressin-neurophysin precursor gene cosegregates with human autosomal dominant neurohypophyseal diabetes insipidus. EMBO J. 1992 Jan;11(1):19-23. [PubMed:1740104 ]
|