Hmdb loader
Identification
HMDB Protein ID HMDBP08900
Secondary Accession Numbers
  • 14629
  • HMDBP09422
Name Cyclin-dependent kinase inhibitor 3
Synonyms
  1. CDK2-associated dual-specificity phosphatase
  2. Cyclin-dependent kinase interactor 1
  3. Cyclin-dependent kinase-interacting protein 2
  4. Kinase-associated phosphatase
Gene Name CDKN3
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
cell cycle arrest
regulation of cyclin-dependent protein kinase activity
G1/S transition of mitotic cell cycle
negative regulation of cell proliferation
Cellular Component
perinuclear region of cytoplasm
Function
phosphoprotein phosphatase activity
phosphoric monoester hydrolase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
protein serine/threonine phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
protein tyrosine phosphatase activity
Process
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
biopolymer modification
dephosphorylation
phosphate metabolic process
phosphorus metabolic process
biopolymer metabolism
macromolecule metabolism
metabolism
physiological process
protein modification
Cellular Location
  1. Cytoplasmic
  2. Cytoplasm
  3. perinuclear region
Gene Properties
Chromosome Location 14
Locus 14q22
SNPs CDKN3
Gene Sequence
>639 bp
ATGAAGCCGCCCAGTTCAATACAAACAAGTGAGTTTGACTCATCAGATGAAGAGCCTATT
GAAGATGAACAGACTCCAATTCATATATCACGGCTATCTTTGTCACGAGTGAATTGTTCT
CAGTTTCTCGGTTTATGTGCTCTTCCAGGTTGTAAATTTAAAGATGTTAGAAGAAATGTC
CAAAAAGATACAGAAGAACTAAAGAGCTGTGGTATACAAGACATATTTGTTTTCTACACC
AGAGGGGAACTGTCAAAATATAGAGTCCCAAACCTTCTGGATCTCTACCAGCAATGTGGA
ATTATCACCCATCATCATCCAATCGCAGATGGAGGGACTCCTGACATAGCCAGCTGCTGT
GAAATAATGGAAGAGCTTACAACCTGCCTTAAAAATTACCGAAAAACCTTAATACACTGC
TATGGAGGACTTGGGAGATCTTGTCTTGTAGCTGCTTGTCTCCTACTATACCTGTCTGAC
ACAATATCACCAGAGCAAGCCATAGACAGCCTGCGAGACCTAAGAGGATCCGGGGCAATA
CAGACCATCAAGCAATACAATTATCTTCATGAGTTTCGGGACAAATTAGCTGCACATCTA
TCATCAAGAGATTCACAATCAAGATCTGTATCAAGATAA
Protein Properties
Number of Residues 212
Molecular Weight 19358.945
Theoretical pI 8.021
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Cyclin-dependent kinase inhibitor 3
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
GenBank ID Protein 12734644
UniProtKB/Swiss-Prot ID Q16667
UniProtKB/Swiss-Prot Entry Name CDKN3_HUMAN
PDB IDs
GenBank Gene ID AF213033
GeneCard ID CDKN3
GenAtlas ID CDKN3
HGNC ID HGNC:1791
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed:12477932 ]
  3. Gyuris J, Golemis E, Chertkov H, Brent R: Cdi1, a human G1 and S phase protein phosphatase that associates with Cdk2. Cell. 1993 Nov 19;75(4):791-803. [PubMed:8242750 ]
  4. Hannon GJ, Casso D, Beach D: KAP: a dual specificity phosphatase that interacts with cyclin-dependent kinases. Proc Natl Acad Sci U S A. 1994 Mar 1;91(5):1731-5. [PubMed:8127873 ]
  5. Yeh CT, Lu SC, Chen TC, Peng CY, Liaw YF: Aberrant transcripts of the cyclin-dependent kinase-associated protein phosphatase in hepatocellular carcinoma. Cancer Res. 2000 Sep 1;60(17):4697-700. [PubMed:10987270 ]
  6. Yeh CT, Lu SC, Chao CH, Chao ML: Abolishment of the interaction between cyclin-dependent kinase 2 and Cdk-associated protein phosphatase by a truncated KAP mutant. Biochem Biophys Res Commun. 2003 May 30;305(2):311-4. [PubMed:12745075 ]
  7. Poon RY, Hunter T: Dephosphorylation of Cdk2 Thr160 by the cyclin-dependent kinase-interacting phosphatase KAP in the absence of cyclin. Science. 1995 Oct 6;270(5233):90-3. [PubMed:7569954 ]
  8. Lee SW, Reimer CL, Fang L, Iruela-Arispe ML, Aaronson SA: Overexpression of kinase-associated phosphatase (KAP) in breast and prostate cancer and inhibition of the transformed phenotype by antisense KAP expression. Mol Cell Biol. 2000 Mar;20(5):1723-32. [PubMed:10669749 ]
  9. Donato JL, Ko J, Kutok JL, Cheng T, Shirakawa T, Mao XQ, Beach D, Scadden DT, Sayegh MH, Adra CN: Human HTm4 is a hematopoietic cell cycle regulator. J Clin Invest. 2002 Jan;109(1):51-8. [PubMed:11781350 ]
  10. Chinami M, Yano Y, Yang X, Salahuddin S, Moriyama K, Shiroishi M, Turner H, Shirakawa T, Adra CN: Binding of HTm4 to cyclin-dependent kinase (Cdk)-associated phosphatase (KAP).Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2. J Biol Chem. 2005 Apr 29;280(17):17235-42. Epub 2005 Jan 24. [PubMed:15671017 ]
  11. Song H, Hanlon N, Brown NR, Noble ME, Johnson LN, Barford D: Phosphoprotein-protein interactions revealed by the crystal structure of kinase-associated phosphatase in complex with phosphoCDK2. Mol Cell. 2001 Mar;7(3):615-26. [PubMed:11463386 ]