Hmdb loader
Identification
HMDB Protein ID HMDBP08190
Secondary Accession Numbers
  • 13901
Name Chloride intracellular channel protein 1
Synonyms
  1. Chloride channel ABP
  2. NCC27
  3. Nuclear chloride ion channel 27
  4. Regulatory nuclear chloride ion channel protein
  5. hRNCC
Gene Name CLIC1
Protein Type Unknown
Biological Properties
General Function Involved in voltage-gated chloride channel activity
Specific Function Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Involved in regulation of the cell cycle
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
ion channel activity
anion channel activity
chloride channel activity
voltage-gated chloride channel activity
Process
establishment of localization
transport
ion transport
anion transport
inorganic anion transport
chloride transport
Cellular Location
  1. Cell membrane
  2. Nucleus
  3. Cytoplasm
  4. Nucleus membrane
  5. Single-pass membrane protein (Probable)
  6. Single-pass membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21.3
SNPs CLIC1
Gene Sequence
>726 bp
ATGGCTGAAGAACAACCGCAGGTCGAATTGTTCGTGAAGGCTGGCAGTGATGGGGCCAAG
ATTGGGAACTGCCCATTCTCCCAGAGACTGTTCATGGTACTGTGGCTCAAGGGAGTCACC
TTCAATGTTACCACCGTTGACACCAAAAGGCGGACCGAGACAGTGCAGAAGCTGTGCCCA
GGGGGGCAGCTCCCATTCCTGCTGTATGGCACTGAAGTGCACACAGACACCAACAAGATT
GAGGAATTTCTGGAGGCAGTGCTGTGCCCTCCCAGGTACCCCAAGCTGGCAGCTCTGAAC
CCTGAGTCCAACACAGCTGGGCTGGACATATTTGCCAAATTTTCTGCCTACATCAAGAAT
TCAAACCCAGCACTCAATGACAATCTGGAGAAGGGACTCCTGAAAGCCCTGAAGGTTTTA
GACAATTACTTAACATCCCCCCTCCCAGAAGAAGTGGATGAAACCAGTGCTGAAGATGAA
GGTGTCTCTCAGAGGAAGTTTTTGGATGGCAACGAGCTCACCCTGGCTGACTGCAACCTG
TTGCCAAAGTTACACATAGTACAGGTGGTGTGTAAGAAGTACCGGGGATTCACCATCCCC
GAGGCCTTCCGGGGAGTGCATCGGTACTTGAGCAATGCCTACGCCCGGGAAGAATTCGCT
TCCACCTGTCCAGATGATGAGGAGATCGAGCTCGCCTATGAGCAAGTGGCAAAGGCCCTC
AAATAA
Protein Properties
Number of Residues 241
Molecular Weight 26922.5
Theoretical pI 4.82
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • 26-46
Protein Sequence
>Chloride intracellular channel protein 1
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCP
GGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKN
SNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNL
LPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKAL
K
GenBank ID Protein 4426567
UniProtKB/Swiss-Prot ID O00299
UniProtKB/Swiss-Prot Entry Name CLIC1_HUMAN
PDB IDs
GenBank Gene ID AF034607
GeneCard ID CLIC1
GenAtlas ID CLIC1
HGNC ID HGNC:2062
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Xie T, Rowen L, Aguado B, Ahearn ME, Madan A, Qin S, Campbell RD, Hood L: Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse. Genome Res. 2003 Dec;13(12):2621-36. [PubMed:14656967 ]
  6. Ribas G, Neville M, Wixon JL, Cheng J, Campbell RD: Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region. J Immunol. 1999 Jul 1;163(1):278-87. [PubMed:10384126 ]
  7. Shanks RA, Larocca MC, Berryman M, Edwards JC, Urushidani T, Navarre J, Goldenring JR: AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member. J Biol Chem. 2002 Oct 25;277(43):40973-80. Epub 2002 Aug 5. [PubMed:12163479 ]
  8. Valenzuela SM, Martin DK, Por SB, Robbins JM, Warton K, Bootcov MR, Schofield PR, Campbell TJ, Breit SN: Molecular cloning and expression of a chloride ion channel of cell nuclei. J Biol Chem. 1997 May 9;272(19):12575-82. [PubMed:9139710 ]
  9. Chuang JZ, Milner TA, Zhu M, Sung CH: A 29 kDa intracellular chloride channel p64H1 is associated with large dense-core vesicles in rat hippocampal neurons. J Neurosci. 1999 Apr 15;19(8):2919-28. [PubMed:10191309 ]
  10. Tonini R, Ferroni A, Valenzuela SM, Warton K, Campbell TJ, Breit SN, Mazzanti M: Functional characterization of the NCC27 nuclear protein in stable transfected CHO-K1 cells. FASEB J. 2000 Jun;14(9):1171-8. [PubMed:10834939 ]
  11. Valenzuela SM, Mazzanti M, Tonini R, Qiu MR, Warton K, Musgrove EA, Campbell TJ, Breit SN: The nuclear chloride ion channel NCC27 is involved in regulation of the cell cycle. J Physiol. 2000 Dec 15;529 Pt 3:541-52. [PubMed:11195932 ]
  12. Berryman M, Bretscher A: Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli. Mol Biol Cell. 2000 May;11(5):1509-21. [PubMed:10793131 ]
  13. Tulk BM, Kapadia S, Edwards JC: CLIC1 inserts from the aqueous phase into phospholipid membranes, where it functions as an anion channel. Am J Physiol Cell Physiol. 2002 May;282(5):C1103-12. [PubMed:11940526 ]
  14. Warton K, Tonini R, Fairlie WD, Matthews JM, Valenzuela SM, Qiu MR, Wu WM, Pankhurst S, Bauskin AR, Harrop SJ, Campbell TJ, Curmi PM, Breit SN, Mazzanti M: Recombinant CLIC1 (NCC27) assembles in lipid bilayers via a pH-dependent two-state process to form chloride ion channels with identical characteristics to those observed in Chinese hamster ovary cells expressing CLIC1. J Biol Chem. 2002 Jul 19;277(29):26003-11. Epub 2002 Apr 26. [PubMed:11978800 ]
  15. Fan L, Yu W, Zhu X: Interaction of Sedlin with chloride intracellular channel proteins. FEBS Lett. 2003 Apr 10;540(1-3):77-80. [PubMed:12681486 ]
  16. Fanucchi S, Adamson RJ, Dirr HW: Formation of an unfolding intermediate state of soluble chloride intracellular channel protein CLIC1 at acidic pH. Biochemistry. 2008 Nov 4;47(44):11674-81. doi: 10.1021/bi801147r. Epub 2008 Oct 14. [PubMed:18850721 ]
  17. Harrop SJ, DeMaere MZ, Fairlie WD, Reztsova T, Valenzuela SM, Mazzanti M, Tonini R, Qiu MR, Jankova L, Warton K, Bauskin AR, Wu WM, Pankhurst S, Campbell TJ, Breit SN, Curmi PM: Crystal structure of a soluble form of the intracellular chloride ion channel CLIC1 (NCC27) at 1.4-A resolution. J Biol Chem. 2001 Nov 30;276(48):44993-5000. Epub 2001 Sep 10. [PubMed:11551966 ]
  18. Littler DR, Harrop SJ, Fairlie WD, Brown LJ, Pankhurst GJ, Pankhurst S, DeMaere MZ, Campbell TJ, Bauskin AR, Tonini R, Mazzanti M, Breit SN, Curmi PM: The intracellular chloride ion channel protein CLIC1 undergoes a redox-controlled structural transition. J Biol Chem. 2004 Mar 5;279(10):9298-305. Epub 2003 Nov 12. [PubMed:14613939 ]