Hmdb loader

Showing Protein cAMP-dependent protein kinase inhibitor alpha (HMDBP08133)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 1 metabolite
Identification
HMDB Protein ID HMDBP08133
Secondary Accession Numbers
  • 13844
Name cAMP-dependent protein kinase inhibitor alpha
Synonyms
  1. PKI-alpha
  2. cAMP-dependent protein kinase inhibitor, muscle/brain isoform
Gene Name PKIA
Protein Type Unknown
Biological Properties
General Function Involved in cAMP-dependent protein kinase inhibitor activity
Specific Function Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains
Pathways Not Available
Reactions Not Available
GO Classification
Function
enzyme regulator activity
enzyme inhibitor activity
kinase inhibitor activity
protein kinase inhibitor activity
protein serine/threonine kinase inhibitor activity
camp-dependent protein kinase inhibitor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of cellular metabolic process
regulation of phosphorus metabolic process
regulation of phosphate metabolic process
regulation of phosphorylation
regulation of kinase activity
negative regulation of kinase activity
negative regulation of protein kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8q21.12
SNPs PKIA
Gene Sequence 
>231 bp
ATGACTGATGTGGAAACTACATATGCAGATTTTATTGCTTCAGGAAGAACAGGTAGAAGA
AATGCAATACATGATATCCTGGTTTCCTCTGCAAGTGGCAACAGCAATGAATTAGCCTTG
AAATTAGCAGGTCTTGATATCAACAAGACAGAAGGTGAAGAAGATGCACAACGAAGTTCT
ACAGAACAAAGTGGGGAAGCCCAGGGAGAAGCAGCAAAATCTGAAAGCTAA
Protein Properties
Number of Residues 76
Molecular Weight 7988.4
Theoretical pI 4.18
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>cAMP-dependent protein kinase inhibitor alpha
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS
TEQSGEAQGEAAKSES
GenBank ID Protein 7208450
UniProtKB/Swiss-Prot ID P61925
UniProtKB/Swiss-Prot Entry Name IPKA_HUMAN
PDB IDs
GenBank Gene ID AF234641
GeneCard ID PKIA
GenAtlas ID PKIA
HGNC ID HGNC:9017
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen SR, Uhler MD: Inhibition of protein kinase-A by overexpression of the cloned human protein kinase inhibitor. Mol Endocrinol. 1991 Sep;5(9):1246-56. [PubMed:1770951 ]