| Identification |
|---|
| HMDB Protein ID
| HMDBP07989 |
| Secondary Accession Numbers
| |
| Name
| Sarcolipin |
| Synonyms
|
Not Available
|
| Gene Name
| SLN |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Involved in enzyme regulator activity |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| cell part |
| membrane |
| Function |
| enzyme regulator activity |
|
| Cellular Location
|
- Single-pass membrane protein
- Sarcoplasmic reticulum membrane
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:1 |
| Locus
| 11q22-q23 |
| SNPs
| SLN |
| Gene Sequence
|
>96 bp
ATGGGGATAAACACCCGGGAGCTGTTTCTCAACTTCACTATTGTCTTGATTACGGTTATT
CTTATGTGGCTCCTTGTGAGGTCCTATCAGTACTGA
|
| Protein Properties |
|---|
| Number of Residues
| 31 |
| Molecular Weight
| 3761.6 |
| Theoretical pI
| 9.17 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Sarcolipin
MGINTRELFLNFTIVLITVILMWLLVRSYQY
|
| External Links |
|---|
| GenBank ID Protein
| 2642411 |
| UniProtKB/Swiss-Prot ID
| O00631 |
| UniProtKB/Swiss-Prot Entry Name
| SARCO_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| U96093 |
| GeneCard ID
| SLN |
| GenAtlas ID
| SLN |
| HGNC ID
| HGNC:11089 |
| References |
|---|
| General References
| - Odermatt A, Taschner PE, Scherer SW, Beatty B, Khanna VK, Cornblath DR, Chaudhry V, Yee WC, Schrank B, Karpati G, Breuning MH, Knoers N, MacLennan DH: Characterization of the gene encoding human sarcolipin (SLN), a proteolipid associated with SERCA1: absence of structural mutations in five patients with Brody disease. Genomics. 1997 Nov 1;45(3):541-53. [PubMed:9367679 ]
- Mascioni A, Karim C, Barany G, Thomas DD, Veglia G: Structure and orientation of sarcolipin in lipid environments. Biochemistry. 2002 Jan 15;41(2):475-82. [PubMed:11781085 ]
|
