Hmdb loader
Identification
HMDB Protein ID HMDBP07714
Secondary Accession Numbers
  • 13423
Name Putative gonadotropin-releasing hormone II receptor
Synonyms
  1. GnRH II receptor
  2. GnRH-II-R
  3. Type II GnRH receptor
Gene Name GNRHR2
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (Potential)
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
molecular transducer activity
signal transducer activity
receptor activity
transmembrane receptor activity
g-protein coupled receptor activity
protein-hormone receptor activity
gonadotropin-releasing hormone receptor activity
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q12
SNPs GNRHR2
Gene Sequence Not Available
Protein Properties
Number of Residues 178
Molecular Weight 19031.1
Theoretical pI 10.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 41-61
  • 78-98
  • 116-136
  • 155-175
Protein Sequence
>Putative gonadotropin-releasing hormone II receptor
MSAGNGTPWGSAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW
SVTRREPSQLRPSPVRRLFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLK
LMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96P88
UniProtKB/Swiss-Prot Entry Name GNRR2_HUMAN
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID GNRHR2
GenAtlas ID GNRHR2
HGNC ID HGNC:16341
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Faurholm B, Millar RP, Katz AA: The genes encoding the type II gonadotropin-releasing hormone receptor and the ribonucleoprotein RBM8A in humans overlap in two genomic loci. Genomics. 2001 Nov;78(1-2):15-8. [PubMed:11707068 ]
  3. Neill JD: GnRH and GnRH receptor genes in the human genome. Endocrinology. 2002 Mar;143(3):737-43. [PubMed:11861490 ]