Hmdb loader

Showing Protein Cytochrome c oxidase subunit 8C, mitochondrial (HMDBP03299)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 metabolites
Identification
HMDB Protein ID HMDBP03299
Secondary Accession Numbers
  • 8877
Name Cytochrome c oxidase subunit 8C, mitochondrial
Synonyms
  1. COX VIII-3
  2. Cytochrome c oxidase polypeptide 8 isoform 3
  3. Cytochrome c oxidase polypeptide VIII isoform 3
  4. Cytochrome c oxidase subunit 8-3
Gene Name COX8C
Protein Type Enzyme
Biological Properties
General Function Involved in cytochrome-c oxidase activity
Specific Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
oxidoreductase activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32.12
SNPs COX8C
Gene Sequence 
>219 bp
ATGCCTCTCCTGCGTGGGCGCTGTCCTGCCCGTCGCCACTACCGCCGCTTGGCCCTGCTC
GGCCTGCAGCCCGCTCCCCGCTTCGCCCACTCGGGGCCCCCGCGCCAGCGGCCCCTGTCT
GCCGCGGAAATGGCTGTTGGACTTGTGGTGTTTTTTACGACCTTCTTAACACCAGCTGCA
TATGTGCTAGGCAACCTGAAGCAGTTCAGAAGGAATTAG
Protein Properties
Number of Residues 72
Molecular Weight 8128.6
Theoretical pI 12.58
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 41-64
Protein Sequence 
>Cytochrome c oxidase subunit 8C, mitochondrial
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA
YVLGNLKQFRRN
GenBank ID Protein 33438742
UniProtKB/Swiss-Prot ID Q7Z4L0
UniProtKB/Swiss-Prot Entry Name COX8C_HUMAN
PDB IDs Not Available
GenBank Gene ID AY161004
GeneCard ID COX8C
GenAtlas ID COX8C
HGNC ID HGNC:24382
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Huttemann M, Schmidt TR, Grossman LI: A third isoform of cytochrome c oxidase subunit VIII is present in mammals. Gene. 2003 Jul 17;312:95-102. [PubMed:12909344 ]