Hmdb loader
Identification
HMDB Protein ID HMDBP03296
Secondary Accession Numbers
  • 8874
Name Cytochrome c oxidase subunit 7A-related protein, mitochondrial
Synonyms
  1. COX7a-related protein
  2. Cytochrome c oxidase subunit VIIa-related protein
  3. EB1
Gene Name COX7A2L
Protein Type Enzyme
Biological Properties
General Function Involved in cytochrome-c oxidase activity
Specific Function May be a regulatory subunit of cytochrome c oxidase that mediates the higher level of energy production in target cells by estrogen
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
mitochondrial membrane part
mitochondrial respiratory chain
Function
catalytic activity
oxidoreductase activity
electron carrier activity
heme-copper terminal oxidase activity
cytochrome-c oxidase activity
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 2p21
SNPs COX7A2L
Gene Sequence
>345 bp
ATGTACTACAAGTTTAGTGGCTTCACGCAGAAGTTGGCAGGAGCATGGGCTTCGGAGGCC
TATAGCCCGCAGGGATTAAAGCCTGTGGTTTCCACAGAAGCACCACCTATCATATTTGCC
ACACCAACTAAACTGACCTCCGATTCCACAGTGTATGATTATGCTGGGAAAAACAAAGTT
CCAGAGCTACAAAAGTTTTTCCAGAAAGCTGATGGTGTGCCCGTCTACCTGAAACGAGGC
CTGCCTGACCAAATGCTTTACCGGACCACCATGGCGCTGACTGTGGGAGGGACCATCTAC
TGCCTGATCGCCCTCTACAATGCTTCGCAGCCCAAAAACAAATGA
Protein Properties
Number of Residues 114
Molecular Weight 12614.6
Theoretical pI 9.81
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytochrome c oxidase subunit 7A-related protein, mitochondrial
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKV
PELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
GenBank ID Protein 2465178
UniProtKB/Swiss-Prot ID O14548
UniProtKB/Swiss-Prot Entry Name COX7R_HUMAN
PDB IDs Not Available
GenBank Gene ID AB007618
GeneCard ID COX7A2L
GenAtlas ID COX7A2L
HGNC ID HGNC:2289
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Schmidt TR, Goodman M, Grossman LI: Molecular evolution of the COX7A gene family in primates. Mol Biol Evol. 1999 May;16(5):619-26. [PubMed:10335655 ]
  4. Watanabe T, Inoue S, Hiroi H, Orimo A, Kawashima H, Muramatsu M: Isolation of estrogen-responsive genes with a CpG island library. Mol Cell Biol. 1998 Jan;18(1):442-9. [PubMed:9418891 ]
  5. Lee N, Daly MJ, Delmonte T, Lander ES, Xu F, Hudson TJ, Mitchell GA, Morin CC, Robinson BH, Rioux JD: A genomewide linkage-disequilibrium scan localizes the Saguenay-Lac-Saint-Jean cytochrome oxidase deficiency to 2p16. Am J Hum Genet. 2001 Feb;68(2):397-409. Epub 2001 Jan 10. [PubMed:11156535 ]