Hmdb loader
Identification
HMDB Protein ID HMDBP03268
Secondary Accession Numbers
  • 8843
Name Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Synonyms
  1. DAD-1
  2. Defender against cell death 1
  3. Oligosaccharyl transferase subunit DAD1
Gene Name DAD1
Protein Type Enzyme
Biological Properties
General Function Involved in dolichyl-diphosphooligosaccharide-protein g
Specific Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis (By similarity).
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
  • Protein processing in endoplasmic reticulum
Reactions
Dolichyl diphosphooligosaccharide + [protein]-L-asparagine → Dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine details
GO Classification
Biological Process
response to drug
response to nutrient
post-translational protein modification
protein N-linked glycosylation via asparagine
apoptotic process
negative regulation of apoptotic process
blastocyst development
Cellular Component
integral to membrane
oligosaccharyltransferase complex
Molecular Function
transferase activity, transferring glycosyl groups
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location 14
Locus 14q11.2
SNPs DAD1
Gene Sequence
>342 bp
ATGTCGGCGTCGGTAGTGTCTGTCATTTCGCGGTTCTTAGAAGAGTACTTGAGCTCCACT
CCGCAGCGTCTGAAGTTGCTGGACGCGTACCTGCTGTATATACTGCTGACCGGGGCGCTG
CAGTTCGGTTACTGTCTCCTCGTGGGGACCTTCCCCTTCAACTCTTTTCTCTCGGGCTTC
ATCTCTTGTGTGGGGAGTTTCATCCTAGCGGTTTGCCTGAGAATACAGATCAACCCACAG
AACAAAGCGGATTTCCAAGGCATCTCCCCAGAGCGAGCCTTTGCTGATTTTCTCTTTGCC
AGCACCATCCTGCACCTTGTTGTCATGAACTTTGTTGGCTGA
Protein Properties
Number of Residues 113
Molecular Weight 12496.55
Theoretical pI 7.076
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
GenBank ID Protein 29501770
UniProtKB/Swiss-Prot ID P61803
UniProtKB/Swiss-Prot Entry Name DAD1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY259117
GeneCard ID DAD1
GenAtlas ID DAD1
HGNC ID HGNC:2664
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Nakashima T, Sekiguchi T, Kuraoka A, Fukushima K, Shibata Y, Komiyama S, Nishimoto T: Molecular cloning of a human cDNA encoding a novel protein, DAD1, whose defect causes apoptotic cell death in hamster BHK21 cells. Mol Cell Biol. 1993 Oct;13(10):6367-74. [PubMed:8413235 ]