| Identification |
|---|
| HMDB Protein ID
| HMDBP02832 |
| Secondary Accession Numbers
| |
| Name
| Interferon beta precursor |
| Synonyms
|
- Fibroblast interferon
- IFN-beta
|
| Gene Name
| IFNB1 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Has antiviral, antibacterial and anticancer activities |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| extracellular region |
| Function |
| signal transducer activity |
| receptor binding |
| cytokine activity |
| hematopoietin/interferon-class (d200-domain) cytokine receptor binding |
| Process |
| response to stimulus |
| response to biotic stimulus |
| defense response |
|
| Cellular Location
|
- Secreted
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:9 |
| Locus
| 9p21 |
| SNPs
| IFNB1 |
| Gene Sequence
|
>564 bp
ATGACCAACAAGTGTCTCCTCCAAATTGCTCTCCTGTTGTGCTTCTCCACTACAGCTCTT
TCCATGAGCTACAACTTGCTTGGATTCCTACAAAGAAGCAGCAATTTTCAGTGTCAGAAG
CTCCTGTGGCAATTGAATGGGAGGCTTGAATACTGCCTCAAGGACAGGATGAACTTTGAC
ATCCCTGAGGAGATTAAGCAGCTGCAGCAGTTCCAGAAGGAGGACGCCGCATTGACCATC
TATGAGATGCTCCAGAACATCTTTGCTATTTTCAGACAAGATTCATCTAGCACTGGCTGG
AATGAGACTATTGTTGAGAACCTCCTGGCTAATGTCTATCATCAGATAAACCATCTGAAG
ACAGTCCTGGAAGAAAAACTGGAGAAAGAAGATTTCACCAGGGGAAAACTCATGAGCAGT
CTGCACCTGAAAAGATATTATGGGAGGATTCTGCATTACCTGAAGGCCAAGGAGTACAGT
CACTGTGCCTGGACCATAGTCAGAGTGGAAATCCTAAGGAACTTTTACTTCATTAACAGA
CTTACAGGTTACCTCCGAAACTGA
|
| Protein Properties |
|---|
| Number of Residues
| 187 |
| Molecular Weight
| 22294.0 |
| Theoretical pI
| 8.91 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Interferon beta precursor
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
|
| External Links |
|---|
| GenBank ID Protein
| 32638 |
| UniProtKB/Swiss-Prot ID
| P01574 |
| UniProtKB/Swiss-Prot Entry Name
| IFNB_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| V00534 |
| GeneCard ID
| IFNB1 |
| GenAtlas ID
| IFNB1 |
| HGNC ID
| HGNC:5434 |
| References |
|---|
| General References
| - Lawn RM, Adelman J, Franke AE, Houck CM, Gross M, Najarian R, Goeddel DV: Human fibroblast interferon gene lacks introns. Nucleic Acids Res. 1981 Mar 11;9(5):1045-52. [PubMed:6164984 ]
- Taniguchi T, Ohno S, Fujii-Kuriyama Y, Muramatsu M: The nucleotide sequence of human fibroblast interferon cDNA. Gene. 1980 Jun;10(1):11-5. [PubMed:6157601 ]
- Derynck R, Content J, DeClercq E, Volckaert G, Tavernier J, Devos R, Fiers W: Isolation and structure of a human fibroblast interferon gene. Nature. 1980 Jun 19;285(5766):542-7. [PubMed:6157094 ]
- Houghton M, Easton MA, Stewart AG, Smith JC, Doel SM, Catlin GH, Lewis HM, Patel TP, Emtage JS, Carey NH, Porter AG: The complete amino acid sequence of human fibroblast interferon as deduced using synthetic oligodeoxyribonucleotide primers of reverse transcriptase. Nucleic Acids Res. 1980 Jul 11;8(13):2885-94. [PubMed:6159580 ]
- Goeddel DV, Shepard HM, Yelverton E, Leung D, Crea R, Sloma A, Pestka S: Synthesis of human fibroblast interferon by E. coli. Nucleic Acids Res. 1980 Sep 25;8(18):4057-74. [PubMed:6159584 ]
- May LT, Sehgal PB: On the relationship between human interferon alpha 1 and beta 1 genes. J Interferon Res. 1985 Summer;5(3):521-6. [PubMed:2414376 ]
- Houghton M, Stewart AG, Doel SM, Emtage JS, Eaton MA, Smith JC, Patel TP, Lewis HM, Porter AG, Birch JR, Cartwright T, Carey NH: The amino-terminal sequence of human fibroblast interferon as deduced from reverse transcripts obtained using synthetic oligonucleotide primers. Nucleic Acids Res. 1980 May 10;8(9):1913-31. [PubMed:6159597 ]
- Wetzel R: Assignment of the disulphide bonds of leukocyte interferon. Nature. 1981 Feb 12;289(5798):606-7. [PubMed:6162107 ]
- Shepard HM, Leung D, Stebbing N, Goeddel DV: A single amino acid change in IFN-beta1 abolishes its antiviral activity. Nature. 1981 Dec 10;294(5841):563-5. [PubMed:6171735 ]
- Karpusas M, Nolte M, Benton CB, Meier W, Lipscomb WN, Goelz S: The crystal structure of human interferon beta at 2.2-A resolution. Proc Natl Acad Sci U S A. 1997 Oct 28;94(22):11813-8. [PubMed:9342320 ]
|
