Hmdb loader
Identification
HMDB Protein ID HMDBP02421
Secondary Accession Numbers
  • 7915
Name cAMP-responsive element modulator
Synonyms
  1. ICER
  2. Inducible cAMP early repressor
Gene Name CREM
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Plays a role in spermatogenesis and is involved in spermatid maturation
Pathways Not Available
Reactions Not Available
GO Classification
Component
nucleus
intracellular membrane-bounded organelle
membrane-bounded organelle
organelle
Function
protein dimerization activity
binding
sequence-specific dna binding transcription factor activity
sequence-specific dna binding
dna binding
nucleic acid binding
protein binding
Process
regulation of transcription, dna-dependent
regulation of transcription
regulation of gene expression
regulation of macromolecule metabolic process
regulation of metabolic process
regulation of biological process
biological regulation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 10p11.21
SNPs CREM
Gene Sequence
>1050 bp
ATGAGCAAATGTGCAAGGAAAAAATATATTAAGACAAATCCAAGACAAATGACCATGGAA
ACAGTTGAATCCCAGCATGATGGAAGTATAACAGCTTCTTTGACAGAGAGCAAGTCTGCT
CATGTGCAGACTCAGACTGGCCAAAATTCAATCCCTGCTTTAGCTCAGGTTTCTGTGGCT
GGATCAGGCACCGGAAGAGGCTCCCCAGCTGTAACTCTAGTGCAGTTACCTTCGGGCCAA
ACTATACATGTCCAGGGAGTAATTCAGACACCACAGCCATCGGTTATTCAGTCATCACAA
ATACACACCGTTCAGGTAGCAGCAATTGCAGAGACAGATGAATCTGCAGAATCAGAAGGT
GTAATTGATTCTCATAAACGTAGAGAAATCCTTTCACGAAGACCCTCTTATAGGAAAATA
CTGAATGAACTGTCCTCTGATGTGCCTGGTGTTCCCAAGATTGAAGAAGAGAGATCAGAG
GAAGAAGGAACACCACCTAGTATTGCTACCATGGCAGTACCAACTAGCATATATCAGACT
AGCACGGGGCAATACATTGCTATAGCCCAAGGTGGAACAATCCAGATTTCTAACCCAGGA
TCTGATGGTGTTCAGGGACTGCAGGCATTAACAATGACAAATTCAGGAGCTCCTCCACCA
GGTGCTACAATTGTACAGTATGCAGCACAATCAGCTGATGGCACACAGCAGTTCTTTGTC
CCAGGCAGCCAGGTTGTTGTTCCAGCTGCCACTGGTGACATGCCAACTTACCAGATCCGA
GCTCCTACTGCTGCTTTGCCACAGGGAGTGGTGATGGCTGCATCGCCCGGAAGTTTGCAC
AGTCCCCAGCAGCTGGCAGAAGAAGCAACACGCAAACGAGAGCTAAGGCTAATGAAAAAC
AGGGAAGCTGCCAAAGAATGTCGACGTCGAAAGAAAGAATATGTAAAATGTCTGGAGAGC
CGAGTTGCAGTGCTGGAAGTCCAGAACAAGAAGCTTATAGAGGAACTTGAAACCTTGAAA
GACATTTGTTCTCCCAAAACAGATTACTAG
Protein Properties
Number of Residues 361
Molecular Weight 38939.6
Theoretical pI 6.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>cAMP-responsive element modulator
MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVA
GSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEG
VIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQT
STGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFV
PGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEE
ATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD
Y
GenBank ID Protein 114630088
UniProtKB/Swiss-Prot ID Q03060
UniProtKB/Swiss-Prot Entry Name CREM_HUMAN
PDB IDs Not Available
GenBank Gene ID XM_001148291
GeneCard ID CREM
GenAtlas ID CREM
HGNC ID HGNC:2352
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  6. Pati D, Meistrich ML, Plon SE: Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis. Mol Cell Biol. 1999 Jul;19(7):5001-13. [PubMed:10373550 ]
  7. Fujimoto T, Fujisawa J, Yoshida M: Novel isoforms of human cyclic AMP-responsive element modulator (hCREM) mRNA. J Biochem. 1994 Feb;115(2):298-303. [PubMed:8206879 ]
  8. Bodor J, Spetz AL, Strominger JL, Habener JF: cAMP inducibility of transcriptional repressor ICER in developing and mature human T lymphocytes. Proc Natl Acad Sci U S A. 1996 Apr 16;93(8):3536-41. [PubMed:8622971 ]
  9. Gellersen B, Kempf R, Sandhowe R, Weinbauer GF, Behr R: Novel leader exons of the cyclic adenosine 3',5'-monophosphate response element modulator (CREM) gene, transcribed from promoters P3 and P4, are highly testis-specific in primates. Mol Hum Reprod. 2002 Nov;8(11):965-76. [PubMed:12397208 ]
  10. Masquilier D, Foulkes NS, Mattei MG, Sassone-Corsi P: Human CREM gene: evolutionary conservation, chromosomal localization, and inducibility of the transcript. Cell Growth Differ. 1993 Nov;4(11):931-7. [PubMed:7916662 ]
  11. Meyer TE, Habener JF: Cyclic AMP response element binding protein CREB and modulator protein CREM are products of distinct genes. Nucleic Acids Res. 1992 Nov 25;20(22):6106. [PubMed:1461747 ]
  12. Vouk K, Hudler P, Strmsnik L, Fink M, Majdic G, Zorn B, Lalli E, Sassone-Corsi P, Debeljak N, Komel R, Rozman D: Combinations of genetic changes in the human cAMP-responsive element modulator gene: a clue towards understanding some forms of male infertility? Mol Hum Reprod. 2005 Aug;11(8):567-74. Epub 2005 Sep 2. [PubMed:16143638 ]
  13. Behr R, Weinbauer GF: CREM activator and repressor isoforms in human testis: sequence variations and inaccurate splicing during impaired spermatogenesis. Mol Hum Reprod. 2000 Nov;6(11):967-72. [PubMed:11044457 ]
  14. Blocher S, Behr R, Weinbauer GF, Bergmann M, Steger K: Different CREM-isoform gene expression between equine and human normal and impaired spermatogenesis. Theriogenology. 2003 Oct 15;60(7):1357-69. [PubMed:14511788 ]