| Identification |
|---|
| HMDB Protein ID
| HMDBP02287 |
| Secondary Accession Numbers
| |
| Name
| Interleukin-3 precursor |
| Synonyms
|
- Hematopoietic growth factor
- IL-3
- MCGF
- Mast-cell growth factor
- Multipotential colony-stimulating factor
- P-cell-stimulating factor
|
| Gene Name
| IL3 |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes |
| Pathways
|
- Fc Epsilon Receptor I Signaling in Mast Cells
|
| Reactions
| Not Available |
| GO Classification
|
| Component |
| extracellular region |
| Function |
| signal transducer activity |
| receptor binding |
| cytokine activity |
| growth factor activity |
| hematopoietin/interferon-class (d200-domain) cytokine receptor binding |
| interleukin-3 receptor binding |
| Process |
| immune response |
| response to stimulus |
| response to biotic stimulus |
| defense response |
|
| Cellular Location
|
- Secreted
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:5 |
| Locus
| 5q31.1 |
| SNPs
| IL3 |
| Gene Sequence
|
>459 bp
ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCT
CCCATGACCCAGACAACGTCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGAT
GAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTGGACTTCAACAACCTCAAT
GGGGAAGACCAAGACATTCTGATGGAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTC
AACAGGGCTGTCAAGAGTTTACAGAACGCATCAGCAATTGAGAGCATTCTTAAAAATCTC
CTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACGCGACATCCAATCCATATCAAGGAC
GGTGACTGGAATGAATTCCGGAGGAAACTGACGTTCTATCTGAAAACCCTTGAGAATGCG
CAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTTTAG
|
| Protein Properties |
|---|
| Number of Residues
| 152 |
| Molecular Weight
| 17233.0 |
| Theoretical pI
| 8.78 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Interleukin-3 precursor
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
|
| External Links |
|---|
| GenBank ID Protein
| 307059 |
| UniProtKB/Swiss-Prot ID
| P08700 |
| UniProtKB/Swiss-Prot Entry Name
| IL3_HUMAN |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| M14743 |
| GeneCard ID
| IL3 |
| GenAtlas ID
| IL3 |
| HGNC ID
| HGNC:6011 |
| References |
|---|
| General References
| - Dorssers L, Burger H, Bot F, Delwel R, Geurts van Kessel AH, Lowenberg B, Wagemaker G: Characterization of a human multilineage-colony-stimulating factor cDNA clone identified by a conserved noncoding sequence in mouse interleukin-3. Gene. 1987;55(1):115-24. [PubMed:3497843 ]
- Otsuka T, Miyajima A, Brown N, Otsu K, Abrams J, Saeland S, Caux C, de Waal Malefijt R, de Vries J, Meyerson P, et al.: Isolation and characterization of an expressible cDNA encoding human IL-3. Induction of IL-3 mRNA in human T cell clones. J Immunol. 1988 Apr 1;140(7):2288-95. [PubMed:3127463 ]
- Yang YC, Ciarletta AB, Temple PA, Chung MP, Kovacic S, Witek-Giannotti JS, Leary AC, Kriz R, Donahue RE, Wong GG, et al.: Human IL-3 (multi-CSF): identification by expression cloning of a novel hematopoietic growth factor related to murine IL-3. Cell. 1986 Oct 10;47(1):3-10. [PubMed:3489530 ]
- Urdal DL, Price V, Sassenfeld HM, Cosman D, Gillis S, Park LS: Molecular characterization of colony-stimulating factors and their receptors: human interleukin-3. Ann N Y Acad Sci. 1989;554:167-76. [PubMed:2544122 ]
- Feng Y, Klein BK, McWherter CA: Three-dimensional solution structure and backbone dynamics of a variant of human interleukin-3. J Mol Biol. 1996 Jun 14;259(3):524-41. [PubMed:8676386 ]
|
