| Identification |
|---|
| HMDB Protein ID
| HMDBP02198 |
| Secondary Accession Numbers
| |
| Name
| Beta-2-microglobulin precursor [Contains: Beta-2-microglobulin variant pI 5.3] |
| Synonyms
|
Not Available
|
| Gene Name
| B2M |
| Protein Type
| Enzyme |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Beta-2-microglobulin is the beta-chain of major histocompatibility complex class I molecules |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
- Secreted
|
| Gene Properties |
|---|
| Chromosome Location
| Chromosome:15 |
| Locus
| 15q21-q22.2 |
| SNPs
| B2M |
| Gene Sequence
|
>360 bp
ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGGC
ATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCA
AATTTCCTGAATTGCTATGTGTCTGGGTTTCATCAATCCGACATTGAAGTTGACTTACTG
AAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGG
TCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGC
CGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAA
|
| Protein Properties |
|---|
| Number of Residues
| 119 |
| Molecular Weight
| 13715.0 |
| Theoretical pI
| 6.51 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>Beta-2-microglobulin precursor [Contains: Beta-2-microglobulin variant pI 5.3]
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
|
| External Links |
|---|
| GenBank ID Protein
| 179318 |
| UniProtKB/Swiss-Prot ID
| P61769 |
| UniProtKB/Swiss-Prot Entry Name
| B2MG_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| M17987 |
| GeneCard ID
| B2M |
| GenAtlas ID
| B2M |
| HGNC ID
| HGNC:914 |
| References |
|---|
| General References
| - Gussow D, Rein R, Ginjaar I, Hochstenbach F, Seemann G, Kottman A, Ploegh HL: The human beta 2-microglobulin gene. Primary structure and definition of the transcriptional unit. J Immunol. 1987 Nov 1;139(9):3132-8. [PubMed:3312414 ]
- Suggs SV, Wallace RB, Hirose T, Kawashima EH, Itakura K: Use of synthetic oligonucleotides as hybridization probes: isolation of cloned cDNA sequences for human beta 2-microglobulin. Proc Natl Acad Sci U S A. 1981 Nov;78(11):6613-7. [PubMed:6171820 ]
- Cunningham BA, Wang JL, Berggard I, Peterson PA: The complete amino acid sequence of beta 2-microglobulin. Biochemistry. 1973 Nov 20;12(24):4811-22. [PubMed:4586824 ]
- Momoi T, Suzuki M, Titani K, Hisanaga S, Ogawa H, Saito A: Amino acid sequence of a modified beta 2-microglobulin in renal failure patient urine and long-term dialysis patient blood. Clin Chim Acta. 1995 May 15;236(2):135-44. [PubMed:7554280 ]
- Bjorkman PJ, Saper MA, Samraoui B, Bennett WS, Strominger JL, Wiley DC: Structure of the human class I histocompatibility antigen, HLA-A2. Nature. 1987 Oct 8-14;329(6139):506-12. [PubMed:3309677 ]
- Saper MA, Bjorkman PJ, Wiley DC: Refined structure of the human histocompatibility antigen HLA-A2 at 2.6 A resolution. J Mol Biol. 1991 May 20;219(2):277-319. [PubMed:2038058 ]
- Collins EJ, Garboczi DN, Karpusas MN, Wiley DC: The three-dimensional structure of a class I major histocompatibility complex molecule missing the alpha 3 domain of the heavy chain. Proc Natl Acad Sci U S A. 1995 Feb 14;92(4):1218-21. [PubMed:7862664 ]
- Smith KJ, Reid SW, Harlos K, McMichael AJ, Stuart DI, Bell JI, Jones EY: Bound water structure and polymorphic amino acids act together to allow the binding of different peptides to MHC class I HLA-B53. Immunity. 1996 Mar;4(3):215-28. [PubMed:8624812 ]
- Okon M, Bray P, Vucelic D: 1H NMR assignments and secondary structure of human beta 2-microglobulin in solution. Biochemistry. 1992 Sep 22;31(37):8906-15. [PubMed:1390678 ]
|
