Hmdb loader
Identification
HMDB Protein ID HMDBP00988
Secondary Accession Numbers
  • 6276
Name Cytochrome b-c1 complex subunit 7
Synonyms
  1. Complex III subunit 7
  2. Complex III subunit VII
  3. QP-C
  4. Ubiquinol-cytochrome c reductase complex 14 kDa protein
Gene Name UQCRB
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquinol-cytochrome-c reductase activity
Specific Function This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This component is involved in redox-linked proton pumping
Pathways Not Available
Reactions Not Available
GO Classification
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
ubiquinol-cytochrome-c reductase activity
Process
metabolic process
cellular metabolic process
generation of precursor metabolites and energy
electron transport chain
respiratory electron transport chain
mitochondrial electron transport, ubiquinol to cytochrome c
Cellular Location
  1. Mitochondrion inner membrane
Gene Properties
Chromosome Location Chromosome:8
Locus 8q22
SNPs UQCRB
Gene Sequence
>336 bp
ATGGCTGGTAAGCAGGCCGTTTCAGCATCAGGCAAGTGGCTGGATGGTATTCGAAAATGG
TATTACAATGCTGCAGGATTCAATAAACTGGGGTTAATGCGAGATGATACAATATACGAG
GATGAAGATGTAAAAGAAGCCATAAGAAGACTTCCTGAGAACCTTTATAATGACAGGATG
TTTCGCATTAAGAGGGCACTGGACCTGAACTTGAAGCATCAGATCTTGCCTAAAGAGCAG
TGGACCAAATATGAAGAGGAAAATTTCTACCTTGAACCGTATCTGAAAGAGGTTATTCGG
GAAAGAAAAGAAAGAGAAGAATGGGCAAAGAAGTAA
Protein Properties
Number of Residues 111
Molecular Weight 13530.3
Theoretical pI 9.23
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytochrome b-c1 complex subunit 7
MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRM
FRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
GenBank ID Protein 37580
UniProtKB/Swiss-Prot ID P14927
UniProtKB/Swiss-Prot Entry Name QCR7_HUMAN
PDB IDs
GenBank Gene ID X13585
GeneCard ID UQCRB
GenAtlas ID UQCRB
HGNC ID HGNC:12582
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Suzuki H, Hosokawa Y, Toda H, Nishikimi M, Ozawa T: Cloning and sequencing of a cDNA for human mitochondrial ubiquinone-binding protein of complex III. Biochem Biophys Res Commun. 1988 Oct 31;156(2):987-94. [PubMed:3056408 ]
  4. Suzuki H, Hosokawa Y, Toda H, Nishikimi M, Ozawa T: Isolation of a single nuclear gene encoding human ubiquinone-binding protein in complex III of mitochondrial respiratory chain. Biochem Biophys Res Commun. 1989 May 30;161(1):371-8. [PubMed:2543413 ]
  5. Suzuki H, Hosokawa Y, Toda H, Nishikimi M, Ozawa T: Common protein-binding sites in the 5'-flanking regions of human genes for cytochrome c1 and ubiquinone-binding protein. J Biol Chem. 1990 May 15;265(14):8159-63. [PubMed:2159470 ]
  6. Haut S, Brivet M, Touati G, Rustin P, Lebon S, Garcia-Cazorla A, Saudubray JM, Boutron A, Legrand A, Slama A: A deletion in the human QP-C gene causes a complex III deficiency resulting in hypoglycaemia and lactic acidosis. Hum Genet. 2003 Jul;113(2):118-22. Epub 2003 Apr 23. [PubMed:12709789 ]